PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AL_180B9CF01.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 205aa    MW: 22646.1 Da    PI: 9.4997
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AL_180B9CF01.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.71e-3262120159
                            ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            ldDgy+WrKYGqK vk+s fprsYYrCt a+C vkk vers++dp++v++tYeg+H h+
  Traes_1AL_180B9CF01.1  62 LDDGYRWRKYGQKAVKNSSFPRSYYRCTAAQCGVKKLVERSQQDPSTVVTTYEGRHGHP 120
                            59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.5E-3349122IPR003657WRKY domain
SuperFamilySSF1182901.7E-2855122IPR003657WRKY domain
PROSITE profilePS5081130.45857122IPR003657WRKY domain
SMARTSM007744.1E-3662121IPR003657WRKY domain
PfamPF031061.0E-2563120IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
AGAESHGCKR GSPVPEEGDE DGSADHHNHR SDEKEQKKKR KGEKKARGSR VAFATKSEVD  60
HLDDGYRWRK YGQKAVKNSS FPRSYYRCTA AQCGVKKLVE RSQQDPSTVV TTYEGRHGHP  120
SPLAAHRGSR MIMATGADTA YSLAALQHQQ HGFFPAGADV YGRMCIQPTT AVAPSLAHRL  180
SEYGGMEVHA DRLPDAVVHY QSRHH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-27551221077Probable WRKY transcription factor 4
2lex_A1e-27551221077Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8273970.0KR827397.1 Triticum aestivum WRKY46 transcriptional factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002441585.17e-47hypothetical protein SORBIDRAFT_09g029810
TrEMBLW4ZM951e-152W4ZM95_WHEAT; Uncharacterized protein
STRINGMLOC_44947.11e-112(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62337173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.13e-40WRKY DNA-binding protein 23
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]